Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGF Rabbit Polyclonal Antibody (HRP)

PIGF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC32646, MGC33136

UniProt

Q07326

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PIGF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_002634

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Karyopherin Alpha 6 (KPNA6) ELISA Kit
MBS9930256 Inquire

Camel Karyopherin Alpha 6 (KPNA6) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal PAX8 Antibody (PAX8/1491 + PAX8/1492) [Alexa Fluor 594]
NBP3-08274AF594 100 µL

Mouse Monoclonal PAX8 Antibody (PAX8/1491 + PAX8/1492) [Alexa Fluor 594]

Sign In for Pricing
View Details
Bovine CDGSH iron sulfur domain containing protein 3, mitochondrial (CISD3) ELISA Kit
GTR10326041 96 Well

Bovine CDGSH iron sulfur domain containing protein 3, mitochondrial (CISD3) ELISA Kit

Sign In for Pricing
View Details
PRMT7 (NM_019023) Human Tagged ORF Clone Lentiviral Particle
RC201672L3V 200 µL

PRMT7 (NM_019023) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human IL38/IL1F10 Antibody
orb3152280-01 50 µg

Human IL38/IL1F10 Antibody

Sign In for Pricing
View Details
Human IL38/IL1F10 Antibody
orb3152280-02 100 µg

Human IL38/IL1F10 Antibody

Sign In for Pricing
View Details