Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R8 Rabbit Polyclonal Antibody (HRP)

PPP1R8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARD1, ARD-1, NIPP1, NIPP-1, PRO2047

UniProt

Q12972

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPP1R8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_054829

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dronedarone Hydrochloride 10mM * 1mL in DMSO
A11389-10mM-D 10 mM x 1mL in DMSO

Dronedarone Hydrochloride 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Recombinant Bordetella Parapertussis folE2 Protein (aa 1-265)
VAng-Lsx4377-1mgEcoli 1 mg (E. coli)

Recombinant Bordetella Parapertussis folE2 Protein (aa 1-265)

Sign In for Pricing
View Details
FOXN4 Antibody
ABD4063 100 µg

FOXN4 Antibody

Sign In for Pricing
View Details
CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (MaxLight 490)
MBS6444606-01 0.1 mL

CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (MaxLight 490)

Sign In for Pricing
View Details
CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (MaxLight 490)
MBS6444606-02 5x 0.1 mL

CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (MaxLight 490)

Sign In for Pricing
View Details
LLGL2 Antibody, FITC conjugated
CSB-PA764711LC01HU-01 50 µg

LLGL2 Antibody, FITC conjugated

Sign In for Pricing
View Details