Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R8 Rabbit Polyclonal Antibody (HRP)

PPP1R8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARD1, ARD-1, NIPP1, NIPP-1, PRO2047

UniProt

Q12972

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPP1R8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_054829

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL18P10 3'UTR Luciferase Stable Cell Line
TU020880 1.0 mL

RPL18P10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
WASL Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV697692 1.0 µg DNA

WASL Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-NA antibody
STJ116153 100 µl

Anti-NA antibody

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Prolactin (PRL)
MBS2048542-01 0.1 mL

APC-Linked Monoclonal Antibody to Prolactin (PRL)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Prolactin (PRL)
MBS2048542-02 0.2 mL

APC-Linked Monoclonal Antibody to Prolactin (PRL)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Prolactin (PRL)
MBS2048542-03 0.5 mL

APC-Linked Monoclonal Antibody to Prolactin (PRL)

Sign In for Pricing
View Details