Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA1 Rabbit Polyclonal Antibody (HRP)

PSMA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NU, HC2, PROS30, HEL-S-275

UniProt

P25786

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PSMA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_002777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Elfn1 shRNA (UAS) - Lentiviral mouse Elfn1 shRNA (UAS, iRFP) plasmid
GTR15105556 1 Vial

Lentiviral mouse Elfn1 shRNA (UAS) - Lentiviral mouse Elfn1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ZNF654 Rabbit Polyclonal Antibody (AP)
orb964785 100 µL

ZNF654 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Mouse Receptor Associated Protein Of The Synapse (RAPSN) ELISA Kit
MBS2704665-01 24 Strip Well

Mouse Receptor Associated Protein Of The Synapse (RAPSN) ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor Associated Protein Of The Synapse (RAPSN) ELISA Kit
MBS2704665-02 48 Strip Well

Mouse Receptor Associated Protein Of The Synapse (RAPSN) ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor Associated Protein Of The Synapse (RAPSN) ELISA Kit
MBS2704665-03 96 Strip Well

Mouse Receptor Associated Protein Of The Synapse (RAPSN) ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor Associated Protein Of The Synapse (RAPSN) ELISA Kit
MBS2704665-04 5x 96 Strip Well

Mouse Receptor Associated Protein Of The Synapse (RAPSN) ELISA Kit

Sign In for Pricing
View Details