Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA1 Rabbit Polyclonal Antibody (FITC)

PSMA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NU, HC2, PROS30, HEL-S-275

UniProt

P25786

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPRT (HPRT1) Human Knockdown Lysate
LY300353 100 µg

HPRT (HPRT1) Human Knockdown Lysate

Sign In for Pricing
View Details
Cdh7 Mouse Gene Knockout Kit (CRISPR)
KN503017 1 Kit

Cdh7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HDGF Rabbit Polyclonal Antibody
TA361936 100 µL

HDGF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF647 conjugate, 0.1mg/mL
BNC471654-100 1x 100 µL

CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: 3G4]
AM09001PU-S 50 µL

CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: 3G4]

Sign In for Pricing
View Details
Cyclin Y (CCNY) (NM_181698) Human Recombinant Protein
TP320991 20 µg

Cyclin Y (CCNY) (NM_181698) Human Recombinant Protein

Sign In for Pricing
View Details