Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMS1 Rabbit Polyclonal Antibody (Biotin)

RBMS1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

YC1, MSSP, SCR2, HCC-4, MSSP-1, MSSP-2, MSSP-3, C2orf12

UniProt

P29558

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RBMS1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC049762 Protein Vector (Mouse) (pPM-C-His)
PV158753 500 ng

BC049762 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
TGFB1 (Transforming Growth Factor, beta 1, CED, DPD1, TGFB, TGFbeta) (HRP)
MBS6182972-01 0.1 mL

TGFB1 (Transforming Growth Factor, beta 1, CED, DPD1, TGFB, TGFbeta) (HRP)

Sign In for Pricing
View Details
TGFB1 (Transforming Growth Factor, beta 1, CED, DPD1, TGFB, TGFbeta) (HRP)
MBS6182972-02 5x 0.1 mL

TGFB1 (Transforming Growth Factor, beta 1, CED, DPD1, TGFB, TGFbeta) (HRP)

Sign In for Pricing
View Details
ARSJ siRNA (Mouse)
CRN4165-01 15 nmol

ARSJ siRNA (Mouse)

Sign In for Pricing
View Details
ARSJ siRNA (Mouse)
CRN4165-02 30 nmol

ARSJ siRNA (Mouse)

Sign In for Pricing
View Details
NEIL1, ID (NEIL1, Endonuclease 8-like 1, DNA glycosylase/AP lyase Neil1, DNA-(apurinic or apyrimidinic site) lyase Neil1, Endonuclease VIII-like 1, FPG1, Nei homolog 1, Nei-like protein 1) (AP)
MBS6324540-01 0.2 mL

NEIL1, ID (NEIL1, Endonuclease 8-like 1, DNA glycosylase/AP lyase Neil1, DNA-(apurinic or apyrimidinic site) lyase Neil1, Endonuclease VIII-like 1, FPG1, Nei homolog 1, Nei-like protein 1) (AP)

Sign In for Pricing
View Details