Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMS1 Rabbit Polyclonal Antibody (HRP)

RBMS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

YC1, MSSP, SCR2, HCC-4, MSSP-1, MSSP-2, MSSP-3, C2orf12

UniProt

P29558

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RBMS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Ribulose 1,5-diphosphate carboxylase from spinach
JAA02723-01 1 U

D-Ribulose 1,5-diphosphate carboxylase from spinach

Sign In for Pricing
View Details
D-Ribulose 1,5-diphosphate carboxylase from spinach
JAA02723-02 2 U

D-Ribulose 1,5-diphosphate carboxylase from spinach

Sign In for Pricing
View Details
D-Ribulose 1,5-diphosphate carboxylase from spinach
JAA02723-03 5 U

D-Ribulose 1,5-diphosphate carboxylase from spinach

Sign In for Pricing
View Details
Rabbit Abhydrolase domain-containing protein 11 (ABHD11) ELISA Kit
MBS7209179-01 48 Well

Rabbit Abhydrolase domain-containing protein 11 (ABHD11) ELISA Kit

Sign In for Pricing
View Details
Rabbit Abhydrolase domain-containing protein 11 (ABHD11) ELISA Kit
MBS7209179-02 96 Well

Rabbit Abhydrolase domain-containing protein 11 (ABHD11) ELISA Kit

Sign In for Pricing
View Details
Rabbit Abhydrolase domain-containing protein 11 (ABHD11) ELISA Kit
MBS7209179-03 5x 96 Well

Rabbit Abhydrolase domain-containing protein 11 (ABHD11) ELISA Kit

Sign In for Pricing
View Details