Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMS1 Rabbit Polyclonal Antibody (Biotin)

RBMS1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

YC1, MSSP, SCR2, HCC-4, MSSP-1, MSSP-2, MSSP-3, C2orf12

UniProt

P29558

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBMS1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

26S Proteasome (26S-PSM) BioAssayTM ELISA Kit (Human)
353541-01 48 Tests

26S Proteasome (26S-PSM) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
26S Proteasome (26S-PSM) BioAssayTM ELISA Kit (Human)
353541-02 96 Tests

26S Proteasome (26S-PSM) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
FAAH2 Polyclonal Antibody
bs-5119R 100 µL

FAAH2 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal VEGFR2/KDR/Flk-1 Antibody (522302) [DyLight 755]
FAB4432Z 0.1 mL

Rat Monoclonal VEGFR2/KDR/Flk-1 Antibody (522302) [DyLight 755]

Sign In for Pricing
View Details
Gastric Inhibitory Polypeptide (GIP) Antibody
abx176564-01 200 µg

Gastric Inhibitory Polypeptide (GIP) Antibody

Sign In for Pricing
View Details
Gastric Inhibitory Polypeptide (GIP) Antibody
abx176564-02 1 mg

Gastric Inhibitory Polypeptide (GIP) Antibody

Sign In for Pricing
View Details