Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMS1 Rabbit Polyclonal Antibody (FITC)

RBMS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

YC1, MSSP, SCR2, HCC-4, MSSP-1, MSSP-2, MSSP-3, C2orf12

UniProt

P29558

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBMS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf31 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0259705 3x 1.0 µg

C8orf31 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Anti Human PXN Monoclonal Clone BIF-16 100ug
IRBAHUPXNBIF16C100ug 100 µg

Rabbit Anti Human PXN Monoclonal Clone BIF-16 100ug

Sign In for Pricing
View Details
PSP (REG1A) Mouse Monoclonal Antibody [Clone ID: OTI7D3]
TA813955S 30 µL

PSP (REG1A) Mouse Monoclonal Antibody [Clone ID: OTI7D3]

Sign In for Pricing
View Details
Mouse Monoclonal SENP2 Antibody (OTI4B3) - Azide and BSA Free
NBP2-74060 100 µg

Mouse Monoclonal SENP2 Antibody (OTI4B3) - Azide and BSA Free

Sign In for Pricing
View Details
YIPF6 Lentiviral Activation Particles (m2)
sc-429600-LAC-2 200 µL

YIPF6 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rat Hippocampus abundant transcript-like protein 1, HIATL1 ELISA Kit
MBS9316357-01 48 Well

Rat Hippocampus abundant transcript-like protein 1, HIATL1 ELISA Kit

Sign In for Pricing
View Details