Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMS1 Rabbit Polyclonal Antibody (HRP)

RBMS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

YC1, MSSP, SCR2, HCC-4, MSSP-1, MSSP-2, MSSP-3, C2orf12

UniProt

P29558

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBMS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTT

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P-Nitrophenyl β-D-cellopentaoside hexadecaacetate
sc-471029 5 mg

P-Nitrophenyl β-D-cellopentaoside hexadecaacetate

Sign In for Pricing
View Details
ANP32B Knockout A2780 Polyclonal Cells
ARG28706 1 Million

ANP32B Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details
Phospho-Tau (Ser516) Rabbit Polyclonal Antibody (PerCP)
orb2554702 100 µL

Phospho-Tau (Ser516) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
ADCY8 Antibody, HRP conjugated
A11963-50UG 50 µg

ADCY8 Antibody, HRP conjugated

Sign In for Pricing
View Details
Goat ALX homeobox protein 1 (ALX1) ELISA kit
GTR10389468 96 Well

Goat ALX homeobox protein 1 (ALX1) ELISA kit

Sign In for Pricing
View Details
Roseburia sp. PCR kit
PCR-V618-96D 100T

Roseburia sp. PCR kit

Sign In for Pricing
View Details