Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRS3 Rabbit Polyclonal Antibody (HRP)

SFRS3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SFRS3, SRp20

UniProt

P84103

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smox Mouse Gene Knockout Kit (CRISPR)
KN516343 1 Kit

Smox Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF740 conjugate, 0.1mg/mL
BNC742550-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B3GALT6 Human Gene Knockout Kit (CRISPR)
KN423942 1 Kit

B3GALT6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human LIF Recombinant Rabbit Monoclonal Antibody [PSH05-96] - BSA and Azide free (Capture)
HA722495 100 µL

Human LIF Recombinant Rabbit Monoclonal Antibody [PSH05-96] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
SCP2 (SYCP2) Human Gene Knockout Kit (CRISPR)
KN216783LP 1 Kit

SCP2 (SYCP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTHFD2 (MTHFD2L) (C-term) Rabbit Polyclonal Antibody
AP52766PU-N 400 µL

MTHFD2 (MTHFD2L) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details