Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPB Rabbit Polyclonal Antibody (HRP)

SNRPB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COD, CCMS, SNRPB1, SmB/B', Sm-B/B', snRNP-B, SmB/SmB'

UniProt

Q66K91

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SNRPB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003082

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYRIC Recombinant Mouse monoclonal Antibody
HA610068 100 µg

LYRIC Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Phospho-TAK1 (S412) Recombinant Rabbit monoclonal Antibody
HA723662 100 µL

Phospho-TAK1 (S412) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ZNF426 Rabbit Polyclonal Antibody
TA383564 100 µL

ZNF426 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Epb41l4a activation kit by CRISPRa
GA201253 1 Kit

Mouse Epb41l4a activation kit by CRISPRa

Sign In for Pricing
View Details
GSTM2 (NM_000848) Human Recombinant Protein
TP310718M 100 µg

GSTM2 (NM_000848) Human Recombinant Protein

Sign In for Pricing
View Details
APC Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139E-01 20 Tests

APC Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details