Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPF Rabbit Polyclonal Antibody (Biotin)

SNRPF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SMF, Sm-F, snRNP-F

UniProt

P62306

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SNRPF

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003086

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSTD1 (NM_001113205) Human Tagged ORF Clone Lentiviral Particle
RC225033L4V 200 µL

TSTD1 (NM_001113205) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Porcine Galectin 2 (GAL2) ELISA Kit
MBS459463-01 48 Tests

Porcine Galectin 2 (GAL2) ELISA Kit

Sign In for Pricing
View Details
Porcine Galectin 2 (GAL2) ELISA Kit
MBS459463-02 96 Tests

Porcine Galectin 2 (GAL2) ELISA Kit

Sign In for Pricing
View Details
Porcine Galectin 2 (GAL2) ELISA Kit
MBS459463-03 5x 96 Tests

Porcine Galectin 2 (GAL2) ELISA Kit

Sign In for Pricing
View Details
Porcine Galectin 2 (GAL2) ELISA Kit
MBS459463-04 10x 96 Tests

Porcine Galectin 2 (GAL2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv.trifolii Indole-3-glycerol phosphate synthase (trpC)
MBS1222296-01 0.02 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv.trifolii Indole-3-glycerol phosphate synthase (trpC)

Sign In for Pricing
View Details