Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XPO1 Rabbit Polyclonal Antibody (Biotin)

XPO1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Emb, CRM1, exp1, CRM-1

UniProt

O14980

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human XPO1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVP

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003391

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRUB1 Rabbit Polyclonal Antibody
TA370576 100 µL

TRUB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AKIRIN2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0067104 1.0 µg DNA

AKIRIN2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Mouse CXCL3 Protein, His (Fc)-Avi-tagged
CXCL3-2098M 50 µg

Recombinant Mouse CXCL3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Gelsolin (GSN, Actin Depolymerizing Factor, ADF, AGEL, Amyloidosis Finnish Type, Brevin, DKFZp313L0718) (Azide Free) (Biotin)
MBS6140312-01 0.1 mL

Gelsolin (GSN, Actin Depolymerizing Factor, ADF, AGEL, Amyloidosis Finnish Type, Brevin, DKFZp313L0718) (Azide Free) (Biotin)

Sign In for Pricing
View Details
Gelsolin (GSN, Actin Depolymerizing Factor, ADF, AGEL, Amyloidosis Finnish Type, Brevin, DKFZp313L0718) (Azide Free) (Biotin)
MBS6140312-02 5x 0.1 mL

Gelsolin (GSN, Actin Depolymerizing Factor, ADF, AGEL, Amyloidosis Finnish Type, Brevin, DKFZp313L0718) (Azide Free) (Biotin)

Sign In for Pricing
View Details
CLDN1 Antibody - C-terminal region : HRP (ARP33623_P050-HRP)
ARP33623_P050-HRP 100 µL

CLDN1 Antibody - C-terminal region : HRP (ARP33623_P050-HRP)

Sign In for Pricing
View Details