Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTCA Rabbit Polyclonal Antibody (HRP)

RTCA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rtcd1

UniProt

Q68FS8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Rtcd1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QHLSGLEMVRDLCDGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NMDA NR2B Subunit (Tyr1252) Antibody
p1516-1252 100 µL

Anti-NMDA NR2B Subunit (Tyr1252) Antibody

Sign In for Pricing
View Details
CQ028, CT (C17orf28, DMC1, Protein hid-1 homolog, Down-regulated in multiple cancers 1) (Azide free) (HRP)
MBS6288531-01 0.2 mL

CQ028, CT (C17orf28, DMC1, Protein hid-1 homolog, Down-regulated in multiple cancers 1) (Azide free) (HRP)

Sign In for Pricing
View Details
CQ028, CT (C17orf28, DMC1, Protein hid-1 homolog, Down-regulated in multiple cancers 1) (Azide free) (HRP)
MBS6288531-02 5x 0.2 mL

CQ028, CT (C17orf28, DMC1, Protein hid-1 homolog, Down-regulated in multiple cancers 1) (Azide free) (HRP)

Sign In for Pricing
View Details
LMBR1L, CT (LMBR1L, KIAA1174, LIMR, Protein LMBR1L, Limb region 1 protein homolog-like, Lipocalin-1-interacting membrane receptor) (Azide free) (HRP)
MBS6316552-01 0.2 mL

LMBR1L, CT (LMBR1L, KIAA1174, LIMR, Protein LMBR1L, Limb region 1 protein homolog-like, Lipocalin-1-interacting membrane receptor) (Azide free) (HRP)

Sign In for Pricing
View Details
LMBR1L, CT (LMBR1L, KIAA1174, LIMR, Protein LMBR1L, Limb region 1 protein homolog-like, Lipocalin-1-interacting membrane receptor) (Azide free) (HRP)
MBS6316552-02 5x 0.2 mL

LMBR1L, CT (LMBR1L, KIAA1174, LIMR, Protein LMBR1L, Limb region 1 protein homolog-like, Lipocalin-1-interacting membrane receptor) (Azide free) (HRP)

Sign In for Pricing
View Details
Rabbit anti-human Ras association and DIL domains polyclonal Antibody
MBS711186-01 0.1 mL

Rabbit anti-human Ras association and DIL domains polyclonal Antibody

Sign In for Pricing
View Details