Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3S4 Rabbit Polyclonal Antibody (HRP)

EIF3S4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF3S4, EIF3-P42, eIF3-p44, eIF3-delta

UniProt

O75821

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3S4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Cell wall integrity and stress response component 4 (WSC4) , partial
MBS7060465 Inquire

Recombinant Saccharomyces cerevisiae Cell wall integrity and stress response component 4 (WSC4) , partial

Sign In for Pricing
View Details
Recombinant Human EIF2S2
MBS7617189-01 0.05 mg

Recombinant Human EIF2S2

Sign In for Pricing
View Details
Recombinant Human EIF2S2
MBS7617189-02 0.2 mg

Recombinant Human EIF2S2

Sign In for Pricing
View Details
Recombinant Human EIF2S2
MBS7617189-03 1 mg

Recombinant Human EIF2S2

Sign In for Pricing
View Details
Recombinant Human EIF2S2
MBS7617189-04 5x 1 mg

Recombinant Human EIF2S2

Sign In for Pricing
View Details
Anti-Myoglobin/MB Antibody Picoband® (Cy3 Conjugate)
A04058-Cy3 100 µg/Vial

Anti-Myoglobin/MB Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details