Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNMT Rabbit Polyclonal Antibody (FITC)

RNMT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MET, Met, CMT1, cm1p, hMet, CMT1c, hCMT1, RG7MT1

UniProt

O43148

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RNMT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003790

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERMP1, CT (ERMP1, FXNA, KIAA1815, Endoplasmic reticulum metallopeptidase 1, Felix-ina) (MaxLight 405)
MBS6296596-01 0.1 mL

ERMP1, CT (ERMP1, FXNA, KIAA1815, Endoplasmic reticulum metallopeptidase 1, Felix-ina) (MaxLight 405)

Sign In for Pricing
View Details
ERMP1, CT (ERMP1, FXNA, KIAA1815, Endoplasmic reticulum metallopeptidase 1, Felix-ina) (MaxLight 405)
MBS6296596-02 5x 0.1 mL

ERMP1, CT (ERMP1, FXNA, KIAA1815, Endoplasmic reticulum metallopeptidase 1, Felix-ina) (MaxLight 405)

Sign In for Pricing
View Details
Human Mitochondrial import receptor subunit TOM5 homolog (TOMM5) ELISA Kit
AE13811HU-01 48 Tests

Human Mitochondrial import receptor subunit TOM5 homolog (TOMM5) ELISA Kit

Sign In for Pricing
View Details
Human Mitochondrial import receptor subunit TOM5 homolog (TOMM5) ELISA Kit
AE13811HU-02 96 Tests

Human Mitochondrial import receptor subunit TOM5 homolog (TOMM5) ELISA Kit

Sign In for Pricing
View Details
FOXC1/2 Rabbit Polyclonal Antibody
orb224169-01 30 µL

FOXC1/2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXC1/2 Rabbit Polyclonal Antibody
orb224169-02 50 μL

FOXC1/2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details