Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNMT Rabbit Polyclonal Antibody (HRP)

RNMT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MET, Met, CMT1, cm1p, hMet, CMT1c, hCMT1, RG7MT1

UniProt

O43148

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNMT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_003790

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FEM1A AAV Vector (Human) (CMV)
20443101 1 µg

FEM1A AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
NOTUM Protein Vector (Mouse) (pPB-N-His)
PV206163 500 ng

NOTUM Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
FAM203A CRISPR Knock Out 293T Cell Line (Human)
19922141 1x 10^6 Cells / 1.0 mL

FAM203A CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
MTA3 Knockout 786-O Polyclonal Cells
ARG5709 1 Million

MTA3 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Rabbit Monoclonal HE4/WFDC2 Antibody (404) [PerCP]
NBP2-90132PCP 0.1 mL

Rabbit Monoclonal HE4/WFDC2 Antibody (404) [PerCP]

Sign In for Pricing
View Details
Rno-miR-30a-3p miRNA Inhibitor
CIR0076-01 10 nmol

Rno-miR-30a-3p miRNA Inhibitor

Sign In for Pricing
View Details