Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNJ1 Rabbit Polyclonal Antibody (Biotin)

SYNJ1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DEE53, EIEE53, INPP5G, PARK20

UniProt

O43426

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SYNJ1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

143kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_982271

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSL2, NT (MSL2, KIAA1585, MSL2L1, RNF184, Male-specific lethal 2 homolog, Male-specific lethal 2-like 1, Male-specific lethal-2 homolog 1, RING finger protein 184) (AP) discontinued
038634-AP 200 µL

MSL2, NT (MSL2, KIAA1585, MSL2L1, RNF184, Male-specific lethal 2 homolog, Male-specific lethal 2-like 1, Male-specific lethal-2 homolog 1, RING finger protein 184) (AP) discontinued

Sign In for Pricing
View Details
USP19 Antibody
orb1255585 100 µL

USP19 Antibody

Sign In for Pricing
View Details
Prostate Specific Antigen Conjugated Antibody
orb1611837 100 µL

Prostate Specific Antigen Conjugated Antibody

Sign In for Pricing
View Details
ARHGEF4, CT (ARHGEF4, KIAA1112, Rho guanine nucleotide exchange factor 4, APC-stimulated guanine nucleotide exchange factor 1) (AP)
MBS6275017-01 0.2 mL

ARHGEF4, CT (ARHGEF4, KIAA1112, Rho guanine nucleotide exchange factor 4, APC-stimulated guanine nucleotide exchange factor 1) (AP)

Sign In for Pricing
View Details
ARHGEF4, CT (ARHGEF4, KIAA1112, Rho guanine nucleotide exchange factor 4, APC-stimulated guanine nucleotide exchange factor 1) (AP)
MBS6275017-02 5x 0.2 mL

ARHGEF4, CT (ARHGEF4, KIAA1112, Rho guanine nucleotide exchange factor 4, APC-stimulated guanine nucleotide exchange factor 1) (AP)

Sign In for Pricing
View Details
XBP1 (X-box Binding Protein 1, XBP-1, Tax-responsive Element-binding Protein 5, TREB5, XBP2) discontinued
X0989-52D 50 µg

XBP1 (X-box Binding Protein 1, XBP-1, Tax-responsive Element-binding Protein 5, TREB5, XBP2) discontinued

Sign In for Pricing
View Details