Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2S2 Rabbit Polyclonal Antibody (Biotin)

EIF2S2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EIF2, EIF2B, PPP1R67, EIF2beta, eIF-2-beta

UniProt

P20042

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2S2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R16B Antibody Blocking Peptide
orb1507767 500 µg

PPP1R16B Antibody Blocking Peptide

Sign In for Pricing
View Details
EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Transporter, 4E-T, eIF4E Transporter, Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1, 2610509L04Rik, FLJ21601, FLJ26551) (APC)
126245-APC 100 µL

EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Transporter, 4E-T, eIF4E Transporter, Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1, 2610509L04Rik, FLJ21601, FLJ26551) (APC)

Sign In for Pricing
View Details
SGF29 (NM_138414) Human Over-expression Lysate
LS112869-20ug 20 µg

SGF29 (NM_138414) Human Over-expression Lysate

Sign In for Pricing
View Details
ATE1 Antibody, Biotin conjugated
CSB-PA002268LD01HU-01 50 µg

ATE1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ATE1 Antibody, Biotin conjugated
CSB-PA002268LD01HU-02 100 µg

ATE1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral human GYG1 sgRNA gene knockout kit - Lentiviral human GYG1 sgRNA gene knockout kit (25)
GTR15370596 1 Vial

Lentiviral human GYG1 sgRNA gene knockout kit - Lentiviral human GYG1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details