Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2S2 Rabbit Polyclonal Antibody (HRP)

EIF2S2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF2, EIF2B, PPP1R67, EIF2beta, eIF-2-beta

UniProt

P20042

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2S2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0476803 1.0 µg DNA

CNOT4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
SSX2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]
TA500618BM 100 µL

SSX2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum LACZ Protein (aa 1-231) (isolate K1 / Thailand)
VAng-Wyb6514-1mgEcoli 1 mg (E. coli)

Recombinant Plasmodium Falciparum LACZ Protein (aa 1-231) (isolate K1 / Thailand)

Sign In for Pricing
View Details
5 (6) -FAM SE 25mg
A21295-25 25 mg

5 (6) -FAM SE 25mg

Sign In for Pricing
View Details
Mouse Monoclonal alpha-1A Adrenergic R/ADRA1A Antibody (518508) [DyLight 405]
FAB10298E 0.1 mL

Mouse Monoclonal alpha-1A Adrenergic R/ADRA1A Antibody (518508) [DyLight 405]

Sign In for Pricing
View Details
Annexin I Polyclonal Conjugated Antibody
orb1618980 100 µL

Annexin I Polyclonal Conjugated Antibody

Sign In for Pricing
View Details