Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2S1 Rabbit Polyclonal Antibody (FITC)

EIF2S1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EIF2, EIF-2, EIF2A, EIF-2A, EIF-2alpha

UniProt

P05198

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EIF2S1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004085

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sulfatase Modifying Factor 1 (SUMF1) ELISA Kit
YP-W15722-01 48 Tests

Human Sulfatase Modifying Factor 1 (SUMF1) ELISA Kit

Sign In for Pricing
View Details
Human Sulfatase Modifying Factor 1 (SUMF1) ELISA Kit
YP-W15722-02 96 Tests

Human Sulfatase Modifying Factor 1 (SUMF1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rhizobium loti NADH-quinone oxidoreductase subunit K (nuoK)
orb2934477-01 20 µg

Recombinant Rhizobium loti NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Rhizobium loti NADH-quinone oxidoreductase subunit K (nuoK)
orb2934477-02 100 µg

Recombinant Rhizobium loti NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
TWEAK (TNF-related Weak Inducer of Apoptosis, APO3 Ligand, APO3/DR3 Ligand, APO3L, CD255, DR3LG, FN14, HCG1991317, MGC129581, MGC20669, Tumor Necrosis Factor Ligand Superfamily Member 12, TNFSF12, UNQ181/PRO207) (MaxLight 750) discontinued
T9185-01-ML750 100 µL

TWEAK (TNF-related Weak Inducer of Apoptosis, APO3 Ligand, APO3/DR3 Ligand, APO3L, CD255, DR3LG, FN14, HCG1991317, MGC129581, MGC20669, Tumor Necrosis Factor Ligand Superfamily Member 12, TNFSF12, UNQ181/PRO207) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CFI Antibody
orb2675236-01 50 µL

CFI Antibody

Sign In for Pricing
View Details