Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILF3 Rabbit Polyclonal Antibody (HRP)

ILF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a, NF90b, NF90c, NFAR2, TCP80, DRBP76, NF110b, NFAR-1, NFAR-2, NFAR90, TCP110, MPP4110, NF90ctv, NFAR110, MPHOSPH4, NF-AT-90

UniProt

Q12906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_004507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Her-2 (ABT077) Antibody (Ready to Use)
V0377R-01 3 mL

Her-2 (ABT077) Antibody (Ready to Use)

Sign In for Pricing
View Details
Her-2 (ABT077) Antibody (Ready to Use)
V0377R-02 6 mL

Her-2 (ABT077) Antibody (Ready to Use)

Sign In for Pricing
View Details
Her-2 (ABT077) Antibody (Ready to Use)
V0377R-03 10 mL

Her-2 (ABT077) Antibody (Ready to Use)

Sign In for Pricing
View Details
ATG9B (NM_173681) Human Over-expression Lysate
LC406556 20 µg

ATG9B (NM_173681) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue, Universal RNA, Canine Adult Normal
T5595-9715 2x100ug

Tissue, Universal RNA, Canine Adult Normal

Sign In for Pricing
View Details
POGK (KIAA1513, Pogo Transposable Element with KRAB Domain, LST003, SLTP003) (PE)
MBS6159551-01 0.1 mL

POGK (KIAA1513, Pogo Transposable Element with KRAB Domain, LST003, SLTP003) (PE)

Sign In for Pricing
View Details