Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILF3 Rabbit Polyclonal Antibody (FITC)

ILF3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a, NF90b, NF90c, NFAR2, TCP80, DRBP76, NF110b, NFAR-1, NFAR-2, NFAR90, TCP110, MPP4110, NF90ctv, NFAR110, MPHOSPH4, NF-AT-90

UniProt

Q12906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_004507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA6, CT (CA6, Carbonic anhydrase 6, Carbonate dehydratase VI, Carbonic anhydrase VI, Salivary carbonic anhydrase, Secreted carbonic anhydrase) (MaxLight 750) discontinued
033115-ML750 100 µL

CA6, CT (CA6, Carbonic anhydrase 6, Carbonate dehydratase VI, Carbonic anhydrase VI, Salivary carbonic anhydrase, Secreted carbonic anhydrase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Pleated Cartridge, Polypro,0.22μm, Chem F&B,30", OD:69mm,226/Fin, Polypro, EPDM, Standard, Rev.0
CFPPP0022F300AG1PES0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Pleated Cartridge, Polypro,0.22μm, Chem F&B,30", OD:69mm,226/Fin, Polypro, EPDM, Standard, Rev.0

Sign In for Pricing
View Details
Human CD273 [PD-L2] Recombinant Protein Fc IgG2a Tag Lyophilized
MBS8431521-01 0.1 mg

Human CD273 [PD-L2] Recombinant Protein Fc IgG2a Tag Lyophilized

Sign In for Pricing
View Details
Human CD273 [PD-L2] Recombinant Protein Fc IgG2a Tag Lyophilized
MBS8431521-02 5x 0.1 mg

Human CD273 [PD-L2] Recombinant Protein Fc IgG2a Tag Lyophilized

Sign In for Pricing
View Details
Recombinant Human BIRC2 Protein, N-GST
MBS1579225-01 0.1 mg

Recombinant Human BIRC2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human BIRC2 Protein, N-GST
MBS1579225-02 1 mg

Recombinant Human BIRC2 Protein, N-GST

Sign In for Pricing
View Details