Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRS10 Rabbit Polyclonal Antibody (Biotin)

SFRS10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SFRS10, SRFS10, TRAN2B, PPP1R156, TRA2-BETA, Htra2-beta

UniProt

P62995

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SFRS10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mettl8 Pre-designed siRNA Set A
SI208356A 1 Each

Rat Mettl8 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Ligand 3 (CCL3) ELISA Kit
YP-W12393-01 48 Tests

Human Chemokine C-C-Motif Ligand 3 (CCL3) ELISA Kit

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Ligand 3 (CCL3) ELISA Kit
YP-W12393-02 96 Tests

Human Chemokine C-C-Motif Ligand 3 (CCL3) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human HEXD sgRNA gene knockout kit - Lentiviral human HEXD sgRNA gene knockout kit (25)
GTR15399819 1 Vial

Lentiviral human HEXD sgRNA gene knockout kit - Lentiviral human HEXD sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MGC24125 Protein Vector (Human) (pPB-C-His)
PV025781 500 ng

MGC24125 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica tRNA 2-thiocytidine biosynthesis protein TtcA 1 (ttcA1)
MBS1356867-01 0.02 mg (E-Coli)

Recombinant Francisella tularensis subsp. holarctica tRNA 2-thiocytidine biosynthesis protein TtcA 1 (ttcA1)

Sign In for Pricing
View Details