Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRS10 Rabbit Polyclonal Antibody (FITC)

SFRS10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SFRS10, SRFS10, TRAN2B, PPP1R156, TRA2-BETA, Htra2-beta

UniProt

P62995

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SFRS10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Aryl hydrocarbon receptor nuclear translocator ELISA Kit
MBS2886379-01 48 Well

Bovine Aryl hydrocarbon receptor nuclear translocator ELISA Kit

Sign In for Pricing
View Details
Bovine Aryl hydrocarbon receptor nuclear translocator ELISA Kit
MBS2886379-02 96 Well

Bovine Aryl hydrocarbon receptor nuclear translocator ELISA Kit

Sign In for Pricing
View Details
Bovine Aryl hydrocarbon receptor nuclear translocator ELISA Kit
MBS2886379-03 5x 96 Well

Bovine Aryl hydrocarbon receptor nuclear translocator ELISA Kit

Sign In for Pricing
View Details
Bovine Aryl hydrocarbon receptor nuclear translocator ELISA Kit
MBS2886379-04 10x 96 Well

Bovine Aryl hydrocarbon receptor nuclear translocator ELISA Kit

Sign In for Pricing
View Details
Stefin B (CSTB) Human Over-expression Lysate
orb1341590 100 µg

Stefin B (CSTB) Human Over-expression Lysate

Sign In for Pricing
View Details
CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (MaxLight 490)
MBS6205748-01 0.1 mL

CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (MaxLight 490)

Sign In for Pricing
View Details