Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRS10 Rabbit Polyclonal Antibody (HRP)

SFRS10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SFRS10, SRFS10, TRAN2B, PPP1R156, TRA2-BETA, Htra2-beta

UniProt

P62995

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SFRS10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TubULin (TUBA1B) Human qPCR Template Standard (NM_006082)
HK207657 1 Kit

TubULin (TUBA1B) Human qPCR Template Standard (NM_006082)

Sign In for Pricing
View Details
BNC1, NT (BNC1, BNC, Zinc finger protein basonuclin-1) (MaxLight 490)
MBS6278687-01 0.1 mL

BNC1, NT (BNC1, BNC, Zinc finger protein basonuclin-1) (MaxLight 490)

Sign In for Pricing
View Details
BNC1, NT (BNC1, BNC, Zinc finger protein basonuclin-1) (MaxLight 490)
MBS6278687-02 5x 0.1 mL

BNC1, NT (BNC1, BNC, Zinc finger protein basonuclin-1) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Polyclonal Thymosin beta 4 Antibody
H00007114-B01P 0.05 mg

Mouse Polyclonal Thymosin beta 4 Antibody

Sign In for Pricing
View Details
Alpha 2 antiplasmin Rabbit Polyclonal Antibody (Cy7)
orb1085418 100 µL

Alpha 2 antiplasmin Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
AP5S1 rabbit pAb
ES18302-01 50 µL

AP5S1 rabbit pAb

Sign In for Pricing
View Details