Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPA Rabbit Polyclonal Antibody (HRP)

SNRPA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

U1A, Mud1, U1-A

UniProt

P09012

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SNRPA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004587

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF-1 alpha (HIF1A) Human Gene Knockout Kit (CRISPR)
KN402461 1 Kit

HIF-1 alpha (HIF1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myosin light chain 3 (MYL3) Mouse Monoclonal Antibody [Clone ID: 3F8]
AM06333SU-N 100 µL

Myosin light chain 3 (MYL3) Mouse Monoclonal Antibody [Clone ID: 3F8]

Sign In for Pricing
View Details
(S)-1-Pyridin-2-yl-ethylamine
TRC-P993405-500MG 500 mg

(S)-1-Pyridin-2-yl-ethylamine

Sign In for Pricing
View Details
CD6 (C6/372), CF640R conjugate, 0.1mg/mL
BNC400372-100 1x 100 µL

CD6 (C6/372), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Cd2ap activation kit by CRISPRa
GA200610 1 Kit

Mouse Cd2ap activation kit by CRISPRa

Sign In for Pricing
View Details
CSNK1G3 Human qPCR Primer Pair (NM_004384)
HP225444 200 Reactions

CSNK1G3 Human qPCR Primer Pair (NM_004384)

Sign In for Pricing
View Details