Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF4 Rabbit Polyclonal Antibody (FITC)

PRPF4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRP4, RP70, HPRP4, Prp4p, HPRP4P, SNRNP60

UniProt

O43172

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004688

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Steap1 (NM_001106629) Rat Tagged ORF Clone
RR211211 10 µg

Steap1 (NM_001106629) Rat Tagged ORF Clone

Sign In for Pricing
View Details
SERPINB13 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
43469124 3x 1.0µg DNA

SERPINB13 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal CCR7 Antibody (2600G) [DyLight 755]
FAB1971Z 0.1 mL

Rabbit Monoclonal CCR7 Antibody (2600G) [DyLight 755]

Sign In for Pricing
View Details
Recombinant Rhesus Macaque TANK Protein, His (Fc)-Avi-tagged
TANK-4431R 50 µg

Recombinant Rhesus Macaque TANK Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Lentiviral mouse Uhrf1 shRNA (UAS) - Lentiviral mouse Uhrf1 shRNA (UAS, RFP) (25)
GTR15242771 1 Vial

Lentiviral mouse Uhrf1 shRNA (UAS) - Lentiviral mouse Uhrf1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-IL-6 Antibody
A00102-1 100 µg

Anti-IL-6 Antibody

Sign In for Pricing
View Details