Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF3 Rabbit Polyclonal Antibody (Biotin)

PRPF3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PRP3, RP18, HPRP3, Prp3p, HPRP3P, SNRNP90

UniProt

O43395

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRPF3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004689

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIP5K1C (KIAA0589, Phosphatidylinositol 4-phosphate 5-kinase Type-1 gamma, Phosphatidylinositol 4-phosphate 5-kinase Type I gamma) (MaxLight 405) discontinued
131363-ML405 100 µL

PIP5K1C (KIAA0589, Phosphatidylinositol 4-phosphate 5-kinase Type-1 gamma, Phosphatidylinositol 4-phosphate 5-kinase Type I gamma) (MaxLight 405) discontinued

Sign In for Pricing
View Details
YbiX Antibody
orb830038 2 mg

YbiX Antibody

Sign In for Pricing
View Details
Phospho-FANCD2 (Ser222) Rabbit Polyclonal Antibody (BF594)
orb2433296 100 µL

Phospho-FANCD2 (Ser222) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Monoclonal Antibody to human CD45 (Clone EO-1)
10-4185-25 25 µg

Monoclonal Antibody to human CD45 (Clone EO-1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Ephrin Type B Receptor 3 (EPHB3)
MBS2073957-01 0.1 mL

HRP-Linked Polyclonal Antibody to Ephrin Type B Receptor 3 (EPHB3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Ephrin Type B Receptor 3 (EPHB3)
MBS2073957-02 0.2 mL

HRP-Linked Polyclonal Antibody to Ephrin Type B Receptor 3 (EPHB3)

Sign In for Pricing
View Details