Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF3 Rabbit Polyclonal Antibody (HRP)

PRPF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PRP3, RP18, HPRP3, Prp3p, HPRP3P, SNRNP90

UniProt

O43395

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRPF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004689

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Geranium Extract
C02938-5mg 5 mg

Geranium Extract

Sign In for Pricing
View Details
ACSL3 (Long-chain-fatty-acid-CoA Ligase 3, Long-chain Acyl-CoA Synthetase 3, FACL3, ACS3, LACS3) (MaxLight 550)
122905-ML550 100 µL

ACSL3 (Long-chain-fatty-acid-CoA Ligase 3, Long-chain Acyl-CoA Synthetase 3, FACL3, ACS3, LACS3) (MaxLight 550)

Sign In for Pricing
View Details
COL20A1 antibody
70R-51056 100 µL

COL20A1 antibody

Sign In for Pricing
View Details
Mouse Cmpk1 Pre-designed siRNA Set A
SI102771A 1 Each

Mouse Cmpk1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Streptomyces scabies L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase (mshC)
MBS1135357-01 0.02 mg (E-Coli)

Recombinant Streptomyces scabies L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase (mshC)

Sign In for Pricing
View Details
Recombinant Streptomyces scabies L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase (mshC)
MBS1135357-02 0.02 mg (Yeast)

Recombinant Streptomyces scabies L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase (mshC)

Sign In for Pricing
View Details