Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP9 Rabbit Polyclonal Antibody (FITC)

RRP9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

U3-55K, RNU3IP2

UniProt

O43818

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RRP9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004695

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (C5/473 + CD5/54/F6), CF488A conjugate, 0.1mg/mL
BNC880748-100 1x 100 µL

CD5 (C5/473 + CD5/54/F6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF740 conjugate, 0.1mg/mL
BNC741807-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106 + TMS715), CF740 conjugate, 0.1mg/mL
BNC740716-500 1x 500 µL

Thymidylate Synthase (TS106 + TMS715), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse PD-1/PDCD1 Protein (His Tag)
PKSM041288-01 10 µg

Recombinant Mouse PD-1/PDCD1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse PD-1/PDCD1 Protein (His Tag)
PKSM041288-02 50 µg

Recombinant Mouse PD-1/PDCD1 Protein (His Tag)

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (rTIMP2/2335), 0.2mg/mL
BNUB2335-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (rTIMP2/2335), 0.2mg/mL

Sign In for Pricing
View Details