Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP3K13 Rabbit Polyclonal Antibody (Biotin)

MAP3K13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LZK, MLK, MEKK13

UniProt

O43283

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence LGTPPALPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCISSCQS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGTPPALPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCISSCQS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_004712

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (PE) discontinued
036977-PE 200 µL

IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (PE) discontinued

Sign In for Pricing
View Details
SLC41A3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
44197126 3x 1.0µg DNA

SLC41A3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
DiagNano™ Protein A conjugated Gold Nanoparticles, 20 nm, 10 OD
GCA-20-10-01 0.5 mL

DiagNano™ Protein A conjugated Gold Nanoparticles, 20 nm, 10 OD

Sign In for Pricing
View Details
DiagNano™ Protein A conjugated Gold Nanoparticles, 20 nm, 10 OD
GCA-20-10-02 1 mL

DiagNano™ Protein A conjugated Gold Nanoparticles, 20 nm, 10 OD

Sign In for Pricing
View Details
SLC23A2 Rabbit Polyclonal Antibody (BF750)
orb2456098 100 µL

SLC23A2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Human NTB-A/SLAMF6 Recombinant Protein
PROTQ96DU3-250ug 250 µg

Human NTB-A/SLAMF6 Recombinant Protein

Sign In for Pricing
View Details