Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPF Rabbit Polyclonal Antibody (Biotin)

HNRNPF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HNRPF, mcs94-1, OK/SW-cl.23

UniProt

P52597

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TGEADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r168 Mouse Gene Knockout Kit (CRISPR)
KN518958 1 Kit

Vmn1r168 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spag7 Mouse Gene Knockout Kit (CRISPR)
KN516532 1 Kit

Spag7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD1 (CD1A) Rabbit Monoclonal Antibody [Clone ID: CBT6]
TA386363 200 µg

CD1 (CD1A) Rabbit Monoclonal Antibody [Clone ID: CBT6]

Sign In for Pricing
View Details
Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein
PKSH033151-01 10 µg

Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein

Sign In for Pricing
View Details
Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein
PKSH033151-02 50 µg

Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein

Sign In for Pricing
View Details
V5 tag Recombinant Rabbit monoclonal Antibody
HA720226F 100 µL

V5 tag Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details