Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFPQ Rabbit Polyclonal Antibody (Biotin)

SFPQ Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PSF, POMP100, PPP1R140

UniProt

P23246

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SFPQ

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005057

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine permeability glycoprotein (P-gp) ELISA Kit
NSL1606Ca 96 Tests

Canine permeability glycoprotein (P-gp) ELISA Kit

Sign In for Pricing
View Details
FEM1A (Protein Fem-1 Homolog A, FEM1a, FEM1-alpha, Prostaglandin E Receptor 4-associated Protein, EPRAP)
MBS6003975-01 0.1 mg

FEM1A (Protein Fem-1 Homolog A, FEM1a, FEM1-alpha, Prostaglandin E Receptor 4-associated Protein, EPRAP)

Sign In for Pricing
View Details
FEM1A (Protein Fem-1 Homolog A, FEM1a, FEM1-alpha, Prostaglandin E Receptor 4-associated Protein, EPRAP)
MBS6003975-02 5x 0.1 mg

FEM1A (Protein Fem-1 Homolog A, FEM1a, FEM1-alpha, Prostaglandin E Receptor 4-associated Protein, EPRAP)

Sign In for Pricing
View Details
OLFM3 (Olfactomedin 3, Olfactomedin-3, NOELIN3, Noelin-3, NOE3, Optimedin, UNQ1924/PRO4399)
MBS628460-01 0.2 mL

OLFM3 (Olfactomedin 3, Olfactomedin-3, NOELIN3, Noelin-3, NOE3, Optimedin, UNQ1924/PRO4399)

Sign In for Pricing
View Details
OLFM3 (Olfactomedin 3, Olfactomedin-3, NOELIN3, Noelin-3, NOE3, Optimedin, UNQ1924/PRO4399)
MBS628460-02 5x 0.2 mL

OLFM3 (Olfactomedin 3, Olfactomedin-3, NOELIN3, Noelin-3, NOE3, Optimedin, UNQ1924/PRO4399)

Sign In for Pricing
View Details
GOSR2 AAV Vector (Rat) (CMV)
22415106 1 µg

GOSR2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details