Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZRSR2 Rabbit Polyclonal Antibody (Biotin)

ZRSR2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

URP, ZC3H22, U2AF1L2, U2AF1RS2, U2AF1-RS2

UniProt

Q15696

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZRSR2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005080

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (AP) discontinued
252741-AP 100 µL

TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (AP) discontinued

Sign In for Pricing
View Details
PDGF Receptor beta (PDGFRB) Rabbit Polyclonal Antibody
AP20314PU-N 100 µg

PDGF Receptor beta (PDGFRB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pop7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6442307 1.0 µg DNA

Pop7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
UBXN10 Rabbit Polyclonal Antibody
orb3070160-01 30 µL

UBXN10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBXN10 Rabbit Polyclonal Antibody
orb3070160-02 50 µL

UBXN10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBXN10 Rabbit Polyclonal Antibody
orb3070160-03 100 µL

UBXN10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details