Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZRSR2 Rabbit Polyclonal Antibody (HRP)

ZRSR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URP, ZC3H22, U2AF1L2, U2AF1RS2, U2AF1-RS2

UniProt

Q15696

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZRSR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005080

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ppt2 Pre-designed siRNA Set B
SI111075B 1 Each

Mouse Ppt2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Bovine ghcagons-like pepfide 1 (GLP-1) ELISA Kit
YP-W78165-01 48 Tests

Bovine ghcagons-like pepfide 1 (GLP-1) ELISA Kit

Sign In for Pricing
View Details
Bovine ghcagons-like pepfide 1 (GLP-1) ELISA Kit
YP-W78165-02 96 Tests

Bovine ghcagons-like pepfide 1 (GLP-1) ELISA Kit

Sign In for Pricing
View Details
SEMA3G CytoSection
TS422035P5 25 Slides

SEMA3G CytoSection

Sign In for Pricing
View Details
HSPB2 Antibody
E308886 200 µL

HSPB2 Antibody

Sign In for Pricing
View Details
TMEM194A (NEMP1) (NM_015257) Human Tagged ORF Clone
RG214148 10 µg

TMEM194A (NEMP1) (NM_015257) Human Tagged ORF Clone

Sign In for Pricing
View Details