Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZRSR2 Rabbit Polyclonal Antibody (HRP)

ZRSR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URP, ZC3H22, U2AF1L2, U2AF1RS2, U2AF1-RS2

UniProt

Q15696

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZRSR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005080

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluor680-conjugated Monoclonal Mouse Anti-Chicken IgY Secondary Antibody
AMS0477-01 200 µL

Fluor680-conjugated Monoclonal Mouse Anti-Chicken IgY Secondary Antibody

Sign In for Pricing
View Details
Fluor680-conjugated Monoclonal Mouse Anti-Chicken IgY Secondary Antibody
AMS0477-02 500 µL

Fluor680-conjugated Monoclonal Mouse Anti-Chicken IgY Secondary Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal HVEM/TNFRSF14 Antibody (2742B) [Janelia Fluor 585]
FAB3563JF585 0.1 mL

Rabbit Monoclonal HVEM/TNFRSF14 Antibody (2742B) [Janelia Fluor 585]

Sign In for Pricing
View Details
IGLV4-69 3'UTR Luciferase Stable Cell Line
TU010955 1.0 mL

IGLV4-69 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZC3H1 Rabbit Polyclonal Antibody
APRab20050-01 20 µL

ZC3H1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZC3H1 Rabbit Polyclonal Antibody
APRab20050-02 50 µL

ZC3H1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details