Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbm8a Rabbit Polyclonal Antibody (Biotin)

Rbm8a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Rbm8

UniProt

Q27W01

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rbm8a

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_215637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAST4 Protein Vector (Human) (pPM-C-His)
PV093385 500 ng

MAST4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Pelodictyon phaeoclathratiforme Arginine--tRNA ligase (argS), partial
MBS1248198 Inquire

Recombinant Pelodictyon phaeoclathratiforme Arginine--tRNA ligase (argS), partial

Sign In for Pricing
View Details
TAS1R2, CT (TAS1R2, GPR71, T1R2, TR2, Taste receptor type 1 member 2, G-protein coupled receptor 71, Sweet taste receptor T1R2)
MBS643481-01 0.2 mL

TAS1R2, CT (TAS1R2, GPR71, T1R2, TR2, Taste receptor type 1 member 2, G-protein coupled receptor 71, Sweet taste receptor T1R2)

Sign In for Pricing
View Details
TAS1R2, CT (TAS1R2, GPR71, T1R2, TR2, Taste receptor type 1 member 2, G-protein coupled receptor 71, Sweet taste receptor T1R2)
MBS643481-02 5x 0.2 mL

TAS1R2, CT (TAS1R2, GPR71, T1R2, TR2, Taste receptor type 1 member 2, G-protein coupled receptor 71, Sweet taste receptor T1R2)

Sign In for Pricing
View Details
EIF2S1, Phosphorylated (S49) (Eukaryotic Translation Initiation Factor 2 Subunit 1, EIF2, EIF-2, EIF2A, EIF-2A, EIF-2alpha) (MaxLight 405)
MBS6415457-01 0.1 mL

EIF2S1, Phosphorylated (S49) (Eukaryotic Translation Initiation Factor 2 Subunit 1, EIF2, EIF-2, EIF2A, EIF-2A, EIF-2alpha) (MaxLight 405)

Sign In for Pricing
View Details
EIF2S1, Phosphorylated (S49) (Eukaryotic Translation Initiation Factor 2 Subunit 1, EIF2, EIF-2, EIF2A, EIF-2A, EIF-2alpha) (MaxLight 405)
MBS6415457-02 5x 0.1 mL

EIF2S1, Phosphorylated (S49) (Eukaryotic Translation Initiation Factor 2 Subunit 1, EIF2, EIF-2, EIF2A, EIF-2A, EIF-2alpha) (MaxLight 405)

Sign In for Pricing
View Details