Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THOC1 Rabbit Polyclonal Antibody (HRP)

THOC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P84, HPR1, P84N5

UniProt

Q96FV9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human THOC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cebpd (CCAAT/Enhancer-Binding Protein delta, C/EBP delta, Transcription Factor CELF, Cebpd, Celf) (MaxLight 405)
MBS6455012-01 0.1 mL

Cebpd (CCAAT/Enhancer-Binding Protein delta, C/EBP delta, Transcription Factor CELF, Cebpd, Celf) (MaxLight 405)

Sign In for Pricing
View Details
Cebpd (CCAAT/Enhancer-Binding Protein delta, C/EBP delta, Transcription Factor CELF, Cebpd, Celf) (MaxLight 405)
MBS6455012-02 5x 0.1 mL

Cebpd (CCAAT/Enhancer-Binding Protein delta, C/EBP delta, Transcription Factor CELF, Cebpd, Celf) (MaxLight 405)

Sign In for Pricing
View Details
Matrix Metalloproteinase 13 (MMP-13, Collagenase 3) (BSA & Azide Free) discontinued
M2428-11A 500 µL

Matrix Metalloproteinase 13 (MMP-13, Collagenase 3) (BSA & Azide Free) discontinued

Sign In for Pricing
View Details
Anti-MPP5/PALS1 Antibody Picoband® Fluoro647 Conjugated
A05311-2-Fluoro647 100 µg/Vial

Anti-MPP5/PALS1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Anti-M-CSFR/CSF1R Antibody, Rabbit Polyclonal
MBS8124683-01 0.1 mL

Anti-M-CSFR/CSF1R Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-M-CSFR/CSF1R Antibody, Rabbit Polyclonal
MBS8124683-02 5x 0.1 mL

Anti-M-CSFR/CSF1R Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details