Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THOC1 Rabbit Polyclonal Antibody (FITC)

THOC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P84, HPR1, P84N5

UniProt

Q96FV9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human THOC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005122

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Tubulin polymerization-promoting protein family member 2, TPPP2 ELISA Kit
MBS9305704-01 48 Well

Bovine Tubulin polymerization-promoting protein family member 2, TPPP2 ELISA Kit

Sign In for Pricing
View Details
Bovine Tubulin polymerization-promoting protein family member 2, TPPP2 ELISA Kit
MBS9305704-02 96 Well

Bovine Tubulin polymerization-promoting protein family member 2, TPPP2 ELISA Kit

Sign In for Pricing
View Details
Bovine Tubulin polymerization-promoting protein family member 2, TPPP2 ELISA Kit
MBS9305704-03 5x 96 Well

Bovine Tubulin polymerization-promoting protein family member 2, TPPP2 ELISA Kit

Sign In for Pricing
View Details
Bovine Tubulin polymerization-promoting protein family member 2, TPPP2 ELISA Kit
MBS9305704-04 10x 96 Well

Bovine Tubulin polymerization-promoting protein family member 2, TPPP2 ELISA Kit

Sign In for Pricing
View Details
HMGCS2 Rabbit mAb
C06219-100uL*2 2x 100μL

HMGCS2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Cytochrome b6 (petB)
MBS7025740-01 0.02 mg

Recombinant Prochlorococcus marinus Cytochrome b6 (petB)

Sign In for Pricing
View Details