Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rod1 Rabbit Polyclonal Antibody (FITC)

Rod1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ro, Rod1, C86549, AA407443, AI462022, AW107884, 5830471K22Rik

UniProt

Q8BHD7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bmi-1 (Polycomb complex protein BMI-1, Polycomb group RING finger protein 4, RING finger protein 51) (Biotin) discontinued
B2185-03C-Biotin 100 µL

Bmi-1 (Polycomb complex protein BMI-1, Polycomb group RING finger protein 4, RING finger protein 51) (Biotin) discontinued

Sign In for Pricing
View Details
VDR (Vitamin D Receptor) Porcine ELISA Kit
I2117 96 Tests

VDR (Vitamin D Receptor) Porcine ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Sodium channel subunit beta-1 (Scn1b)
orb2902910-01 20 µg

Recombinant Mouse Sodium channel subunit beta-1 (Scn1b)

Sign In for Pricing
View Details
Recombinant Mouse Sodium channel subunit beta-1 (Scn1b)
orb2902910-02 100 µg

Recombinant Mouse Sodium channel subunit beta-1 (Scn1b)

Sign In for Pricing
View Details
Human SLC30A8 auto ELISA Kit
orb407302-01 24 Tests

Human SLC30A8 auto ELISA Kit

Sign In for Pricing
View Details
Human SLC30A8 auto ELISA Kit
orb407302-02 48 Tests

Human SLC30A8 auto ELISA Kit

Sign In for Pricing
View Details