Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rod1 Rabbit Polyclonal Antibody (HRP)

Rod1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ro, Rod1, C86549, AA407443, AI462022, AW107884, 5830471K22Rik

UniProt

Q8BHD7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-52433R-PE-Cy5.5 100 µL

PARP Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Arl14epl (NM_001033446) Mouse Tagged ORF Clone
MG214735 10 µg

Arl14epl (NM_001033446) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ELISA Kit For Acetolactate synthase-like protein
E5753b 96 Tests

ELISA Kit For Acetolactate synthase-like protein

Sign In for Pricing
View Details
Quick Step Human Epstein-Barr virus nuclear antigen (EBNA) elisa kit
QS2456Hu-01 48 Tests

Quick Step Human Epstein-Barr virus nuclear antigen (EBNA) elisa kit

Sign In for Pricing
View Details
Quick Step Human Epstein-Barr virus nuclear antigen (EBNA) elisa kit
QS2456Hu-02 96 Tests

Quick Step Human Epstein-Barr virus nuclear antigen (EBNA) elisa kit

Sign In for Pricing
View Details
ZNF879 siRNA Oligos set (Human)
51901171 3x 5 nmol

ZNF879 siRNA Oligos set (Human)

Sign In for Pricing
View Details