Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rod1 Rabbit Polyclonal Antibody (HRP)

Rod1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ro, Rod1, C86549, AA407443, AI462022, AW107884, 5830471K22Rik

UniProt

Q8BHD7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MOSPD1 Antibody
NBP2-83220-0.1mL 0.1 mL

Rabbit Polyclonal MOSPD1 Antibody

Sign In for Pricing
View Details
Biotinylated Anti-FGFR3 (vofatamab biosimilar) mAb
MBS1880818-01 0.05 mg

Biotinylated Anti-FGFR3 (vofatamab biosimilar) mAb

Sign In for Pricing
View Details
Biotinylated Anti-FGFR3 (vofatamab biosimilar) mAb
MBS1880818-02 0.1 mg

Biotinylated Anti-FGFR3 (vofatamab biosimilar) mAb

Sign In for Pricing
View Details
Biotinylated Anti-FGFR3 (vofatamab biosimilar) mAb
MBS1880818-03 5x 0.1 mg

Biotinylated Anti-FGFR3 (vofatamab biosimilar) mAb

Sign In for Pricing
View Details
TREM2 Rabbit Polyclonal Antibody
orb2950878-01 50 µg

TREM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TREM2 Rabbit Polyclonal Antibody
orb2950878-02 100 µg

TREM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details