Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNUPN Rabbit Polyclonal Antibody (HRP)

SNUPN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KPNBL, RNUT1, Snurportin1

UniProt

O95149

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SNUPN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_005692

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAD2L2 Protein Lysate
OCOA18496-20UG 20 µg

MAD2L2 Protein Lysate

Sign In for Pricing
View Details
Col14a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3394305 3x 1.0 µg

Col14a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Dhx33 Pre-designed siRNA Set A
SI103629A 1 Each

Mouse Dhx33 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cdc4 (FBXW7, F-box and WD repeat domain containing 7, AGO, Archipelago homolog, DKFZp686F23254, F-box/WD repeat-containing protein 7, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, FBW6, FBW7, FBX30, FBXO30, FBXW6, FLJ11071, FLJ16457, hAgo, hCdc4, SEL10, SEL-10) (APC)
C2549-70-APC 100 µL

Cdc4 (FBXW7, F-box and WD repeat domain containing 7, AGO, Archipelago homolog, DKFZp686F23254, F-box/WD repeat-containing protein 7, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, FBW6, FBW7, FBX30, FBXO30, FBXW6, FLJ11071, FLJ16457, hAgo, hCdc4, SEL10, SEL-10) (APC)

Sign In for Pricing
View Details
DNA pol λ Antibody
E18-9055-2 100 µg -100 µL

DNA pol λ Antibody

Sign In for Pricing
View Details
Tissue Inhibitors of Metalloproteinase 3 (TIMP3) Rat ELISA Kit
H6347 96 Tests

Tissue Inhibitors of Metalloproteinase 3 (TIMP3) Rat ELISA Kit

Sign In for Pricing
View Details