Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Srrm1 Rabbit Polyclonal Antibody (Biotin)

Srrm1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSPVQSQSPSTNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101456

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: left
CS637730 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
SMCP Mouse Monoclonal Antibody [Clone ID: OTI6G9]
CF807753 100 µg

SMCP Mouse Monoclonal Antibody [Clone ID: OTI6G9]

Sign In for Pricing
View Details
AluI, 50U
RE1120 50 U

AluI, 50U

Sign In for Pricing
View Details
ENDOD1 Human Gene Knockout Kit (CRISPR)
KN417810 1 Kit

ENDOD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Diethylamine (Nitric Oxide) Adduct
TRC-D443500-50MG 50 mg

Diethylamine (Nitric Oxide) Adduct

Sign In for Pricing
View Details
MAD2L1 binding protein (MAD2L1BP) Human Gene Knockout Kit (CRISPR)
KN402640 1 Kit

MAD2L1 binding protein (MAD2L1BP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details