Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Srrm1 Rabbit Polyclonal Antibody (FITC)

Srrm1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSPVQSQSPSTNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101456

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0391 Antibody
orb2681696-01 50 µL

KIAA0391 Antibody

Sign In for Pricing
View Details
KIAA0391 Antibody
orb2681696-02 100 µL

KIAA0391 Antibody

Sign In for Pricing
View Details
KIAA0391 Antibody
orb2681696-03 200 µL

KIAA0391 Antibody

Sign In for Pricing
View Details
Recombinant Murine GDNF
P6164-10μg 10 µg

Recombinant Murine GDNF

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yhfH (yhfH)
MBS1179520-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein yhfH (yhfH)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yhfH (yhfH)
MBS1179520-02 0.1 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein yhfH (yhfH)

Sign In for Pricing
View Details