Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Srrm1 Rabbit Polyclonal Antibody (HRP)

Srrm1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSPVQSQSPSTNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101456

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PGAP2 activation kit by CRISPRa
GA109117 1 Kit

Human PGAP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Multi-parameter Analyzer BMET-601
BMET-601 1 Unit

Multi-parameter Analyzer BMET-601

Sign In for Pricing
View Details
KCTD6 (NM_001128214) Human Over-expression Lysate
LC426928 20 µg

KCTD6 (NM_001128214) Human Over-expression Lysate

Sign In for Pricing
View Details
B3GAT1 Rabbit Polyclonal Antibody
HA500443 100 µL

B3GAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD30 (Ki-1/779), 1mg/mL
BNUM0779-50 1x 50 µL

CD30 (Ki-1/779), 1mg/mL

Sign In for Pricing
View Details
Otelixizumab Biosimilar - Research Grade
ICH5171-50mg 50 mg

Otelixizumab Biosimilar - Research Grade

Sign In for Pricing
View Details