Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Srrm1 Rabbit Polyclonal Antibody (HRP)

Srrm1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSPVQSQSPSTNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101456

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Stomach
CS644334 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Delta-Guanido-Alpha-ketovaleric Acid
TRC-G412100-25MG 25 mg

Delta-Guanido-Alpha-ketovaleric Acid

Sign In for Pricing
View Details
Ku80 (XRCC5) Rabbit Polyclonal Antibody
AP06208PU-N 100 µg

Ku80 (XRCC5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSMD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]
TA503219AM 100 µL

PSMD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF488A conjugate, 0.1mg/mL
BNC882290-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Didecylamine
TRC-D439430-1G 1 g

Didecylamine

Sign In for Pricing
View Details