Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B4 Rabbit Polyclonal Antibody (HRP)

SF3B4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AFD1, Hsh49, SAP49, SF3b49

UniProt

Q15427

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005841

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS801625 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
FOXP1 (NM_032682) Human Over-expression Lysate
LY403191 100 µg

FOXP1 (NM_032682) Human Over-expression Lysate

Sign In for Pricing
View Details
KIAA1530 (UVSSA) (NM_020894) Human Recombinant Protein
TP310690M 100 µg

KIAA1530 (UVSSA) (NM_020894) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant hCG beta Monoclonal Antibody
AN301544L-01 50 µL

Recombinant hCG beta Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant hCG beta Monoclonal Antibody
AN301544L-02 100 µL

Recombinant hCG beta Monoclonal Antibody

Sign In for Pricing
View Details
HER2 (Ab-877) Antibody
8B7105-AAT 50 µg

HER2 (Ab-877) Antibody

Sign In for Pricing
View Details